PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015899334.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family ARR-B
Protein Properties Length: 512aa    MW: 57992.6 Da    PI: 4.3464
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015899334.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like70.52.5e-22166219155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k++l+W+ eLH++F++av+ L G+e A Pktil++m+v+gL+ e++  HLQkYR+
  XP_015899334.1 166 KAKLVWSDELHTKFLQAVNAL-GIEDAHPKTILQHMNVPGLAKENISGHLQKYRI 219
                     689******************.9*******************************7 PP

2Response_reg25.37.5e-1069222108
                     TCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHH CS
    Response_reg  22 gyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelv 108
                     ++ +  +a+++ +a  ++kek+    lil  + +p+m+ +e++++ ++ + klp +++++ +++  +l  l  Ga  +l+Kp+  +++ 
  XP_015899334.1   6 HF-HLLTATTAADAFSIIKEKEdeLKLILAEVHLPDMNRYEFIEKVTQVS-KLPLVIMSDDDDDISMLGGLFKGATFYLVKPVTLNNMK 92 
                     55.6678999999*****888888**********************9999.*******************************9988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.57E-13198IPR011006CheY-like superfamily
PROSITE profilePS5011021.153199IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23002.1E-141124No hitNo description
PfamPF000728.0E-6393IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF466891.22E-14164223IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-22164223IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-18166219IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MLNARHFHLL TATTAADAFS IIKEKEDELK LILAEVHLPD MNRYEFIEKV TQVSKLPLVI  60
MSDDDDDISM LGGLFKGATF YLVKPVTLNN MKNLWQFAYM NNKDLLQFSD SGEENNNNIV  120
QIESQGENAA ADDEVSKDKR KREEEISDNK DEEINEDNDD SKAPKKAKLV WSDELHTKFL  180
QAVNALGIED AHPKTILQHM NVPGLAKENI SGHLQKYRIS LKREQDAIML KSMSRDCFDE  240
PGFASFSCSS SSRIFNLQEG TFVQFPNHYF SSTTTSSKPQ FGVPFQKNLI TTTTTHISMP  300
NSFEYSAYYN HHPNPDYDLL YLMSTGTRNE TLFAMTCKQI SSNPTGMGIT NNSMELAGGI  360
GIGEFWESNF IKKEEEEDIF NGKMSFSNVL VSDFGNAKDI PTLLDDSEQQ VEQVEQIPVL  420
STTTTTTPPA QSEKQEKIDI FGEKSGETEL FDFTKQSTVV FRDEDLDDFW DSSLYYMPAF  480
GVVNNHEIQN FLYMQYSTTL PTSSTDTFEE GP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-16163223262ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015899334.10.0PREDICTED: two-component response regulator ORR23-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF145541114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01760.12e-32response regulator 14